Loading...
Statistics
Advertisement

Osunramp.org

Advertisement
Conversion Technology Metas Server
Osunramp.org is hosted in Virgin Islands, British / Road Town . Osunramp.org doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Osunramp.org

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Powered by

  • PHP/5.3.29

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Osunramp.org

Missing HTTPS protocol.

    Meta - Osunramp.org

    Number of occurences: 2
    • Name: robots
      Content: noarchive
    • Name: googlebot
      Content: nosnippet

    Server / Hosting

    • IP: 204.11.56.48
    • Latitude: 18.42
    • Longitude: -64.62
    • Country: Virgin Islands, British
    • City: Road Town

    Rname

    • ns2648.ztomy.com
    • ns1648.ztomy.com

    Target

    • abuse.opticaljungle.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Fri, 22 Jul 2016 18:26:27 GMT Server: Apache X-Powered-By: PHP/5.3.29 Content-Type: text/html X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Transfer-Encoding: chunked Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

    DNS

    host: osunramp.org
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 204.11.56.48
    host: osunramp.org
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2648.ztomy.com
    host: osunramp.org
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1648.ztomy.com
    host: osunramp.org
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: ns1648.ztomy.com
    5. rname: abuse.opticaljungle.com
    6. serial: 2011062801
    7. refresh: 3600
    8. retry: 900
    9. expire: 604800
    10. minimum-ttl: 86400
    host: osunramp.org
    1. class: IN
    2. ttl: 300
    3. type: PTR
    4. target: ns1648.ztomy.com
    host: osunramp.org
    1. class: IN
    2. ttl: 300
    3. type: TXT
    4. txt: v=spf1 a -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.sunramp.org, www.obsunramp.org, www.bsunramp.org, www.ohsunramp.org, www.hsunramp.org, www.ogsunramp.org, www.gsunramp.org, www.ojsunramp.org, www.jsunramp.org, www.omsunramp.org, www.msunramp.org, www.o sunramp.org, www. sunramp.org, www.ovsunramp.org, www.vsunramp.org, www.ounramp.org, www.oseunramp.org, www.oeunramp.org, www.oswunramp.org, www.owunramp.org, www.osdunramp.org, www.odunramp.org, www.osxunramp.org, www.oxunramp.org, www.osfunramp.org, www.ofunramp.org, www.osgunramp.org, www.ogunramp.org, www.ostunramp.org, www.otunramp.org, www.osnramp.org, www.osuwnramp.org, www.oswnramp.org, www.osuenramp.org, www.osenramp.org, www.osusnramp.org, www.ossnramp.org, www.osuanramp.org, www.osanramp.org, www.osuramp.org, www.osunnramp.org, www.osunramp.org, www.osunhramp.org, www.osuhramp.org, www.osunjramp.org, www.osujramp.org, www.osunkramp.org, www.osukramp.org, www.osunlramp.org, www.osulramp.org, www.osun ramp.org, www.osu ramp.org, www.osunamp.org, www.osunriamp.org, www.osuniamp.org, www.osunroamp.org, www.osunoamp.org, www.osunrlamp.org, www.osunlamp.org, www.osunrlamp.org, www.osunlamp.org, www.osunr.amp.org, www.osun.amp.org, www.osunrmp.org, www.osunraomp.org, www.osunromp.org, www.osunrapmp.org, www.osunrpmp.org, www.osunra9mp.org, www.osunr9mp.org, www.osunramp.org, www.osunrmp.org, www.osunraimp.org, www.osunrimp.org, www.osunraump.org, www.osunrump.org, www.osunrap.org, www.osunrampp.org, www.osunrapp.org, www.osunramop.org, www.osunraop.org, www.osunramip.org, www.osunraip.org, www.osunramkp.org, www.osunrakp.org, www.osunram.p.org, www.osunra.p.org, www.osunramup.org, www.osunraup.org, www.osunramjp.org, www.osunrajp.org, www.osunramnp.org, www.osunranp.org, www.osunram-p.org, www.osunra-p.org, www.osunram.org, www.osunrampi.org, www.osunrami.org, www.osunrampk.org, www.osunramk.org, www.osunrampu.org, www.osunramu.org, www.osunrampj.org, www.osunramj.org, www.osunrampl.org, www.osunraml.org,

    Other websites we recently analyzed

    1. Steven Lange Books |
      Houston (United States) - 192.232.219.69
      Server software: nginx/1.10.0
      Technology: CSS, Datepicker, Flexslider, Google Font API, Gravatar, Html, Html5, Iframe, Javascript, jQuery, jQuery UI, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress, Facebook Like button, Facebook Box, Twitter Button
      Number of Javascript: 39
      Number of meta tags: 5
    2. null
      Korea, Republic of - 211.241.100.47
      Server software:
      Technology: Html, Javascript
      Number of meta tags: 3
    3. howsyoursoil.com
      Wayne (United States) - 216.250.120.153
      Server software: squid/3.5.14
      Technology: Html
      Number of meta tags: 3
    4. Best Buy Travels & Tours
      Tempe (United States) - 69.160.32.58
      Server software: nginx admin
      Technology: Maxcdn, OSS CDN, CSS, Font Awesome, Google Font API, Html, Html5, jQuery
      Number of Javascript: 2
      Number of meta tags: 4
    5. San Diego Employment Law And Business Law Attorney | Palm Springs CA
      Contact Donald R. Holben & Associates, APC, in San Diego, California, at 619-780-2820 for legal advice and representation.
      Europe - 2.20.188.249
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Javascript, Php, Omniture, SiteCatalyst
      Number of Javascript: 9
      Number of meta tags: 16
    6. Angela Mercedes Donna Otto's Portfolio
      Germany - 89.107.184.29
      Server software: nginx/1.2.1
      Technology: CSS, Html, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 1
    7. Ассоциация служб такси российской федерации
      Nürnberg (Germany) - 88.198.0.162
      Server software: nginx/1.8.1
      Technology: Maxcdn, OSS CDN, CSS, Html, Html5, Javascript, jQuery, Yandex.Metrika
      Number of Javascript: 4
      Number of meta tags: 2
    8. AWAY REALTY | Лучшее агентство зарубежной недвижимости
      HOMES.RU - AWAY REALTY: Элитная зарубежная недвижимость, элитная недвижимость за рубежом, продажа домов за рубежом, квартира, апартаменты, вилла, пентхаус, коттедж, таунхаус, особняк, дача, бунгало, офис, земля, земельный участок, страны мира, Европа, острова, экзотика, правовая информация, визы, описание страны по недвижимости, Австрия, Великобритания, Германия, Испания, Италия, Португалия, Франция, Хорватия, Черногория.
      Netherlands - 109.206.190.54
      Server software: nginx/1.10.1
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Yandex.Metrika
      Number of Javascript: 4
      Number of meta tags: 5
    9. sariyerevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    10. Riverlands Equestrian - Welcome
      Riverlands Equestrian Facility
      San Francisco (United States) - 199.34.228.58
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 5
      Number of meta tags: 4

    Check Other Websites